Endotrophin Precision Assay Kits-Updated
Endotrophin (ETP) A New Peptide Fragment from the C-Terminal Globular Domain of Collagen 6A3 is A Novel Biomarker for Fibrosis, Cardiovascular Disease (HF, CAD), Obesity, Insulin Resistance and Cancer Research.
How endotrophin affects metabolism and Obesity:
• Fibrosis: Endotrophin can trigger fibrosis in adipose tissue, which can lead to metabolic dysfunction.
• Inflammation: Endotrophin can trigger inflammation in adipose tissue, which can lead to metabolic dysfunction.
• Insulin resistance: Endotrophin can contribute to insulin resistance, which can lead to metabolic dysfunction.
• Autophagic flux impairment: High levels of endotrophin can impair autophagic flux in adipocytes, which can contribute to metabolic dysfunction.
• Endotrophin as a treatment target: Endotrophin has been identified as a potential target for treating obesity and other metabolic dysfunctions. It has also been shown to drive pathological changes, and thereby can serve as a drug target.
• Endotrophin in disease: Endotrophin levels have been associated with disease severity in multiple disease states, including heart failure, polycystic ovary syndrome, and diabet.
Endotrophin is a peptide from Collagen 6A3 that’s linked to obesity and metabolic dysfunction. High levels of endotrophin in adipocytes are associated with insulin resistance, inflammation, and apoptosis.
The COL6A3 gene is expressed in a variety of tissues, including the brain, adipose tissue, pancreas and heart.
• Brain: In the adult mouse brain, COL6A3 is expressed throughout, with the highest
levels in the midbrain and brainstem. Neurons, but not astroglia, are the cellular
source of COL6A3 in the brain.
• Adipose tissue: COL6A3 expression in adipocytes is associated with insulin resistance
COL6A3 expression in adipocytes depends on adipocyte size and PPARγ
• Pancreas: In the normal pancreas, COL6A3 is expressed in the connective tissue
around the ducts.
• Heart: The COL6A3 gene is expressed primarily within cardiac fibroblasts. Elevated
expression of COL6A3 is linked to cardiac fibrosis or coronary artery disease, a
condition where excessive extracellular matrix is produced in response to injury
or stress.
Studies have investigated the potential of targeting COL6A3-derived peptides like “endotrophin” as a therapeutic approach for heart disease due to its role in fibrosis development.

Feature of Aviscera Bioscience’s Human Endotrophin ELISA Kit:
• Antibody Pair High Sensitivity formulation.
• Validated on Western Blot.
• Calibation by human Endotrophin His Tag derived from
HEK293 which with three disulfide bonds.
• Endogenous Endotrophin Peptide Tested.





Human Endotrophin (Ala1-Thr91)
1 ARSASSSTINLMVSTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENK
FGSQKECEKVCAPVLAKPGVISVMGT 91


MOUSE ENDOTROPHIN (A1-V82)
1AHRASSST INLMVNTEPL FLTKTDICKL SRDAGTCVDF KLLWHYDLES KSCKRFWYGG CGGNENRFHS QEECEKMCSP ELTV 82




| Product Name | Catalog No. | Size |
| Human Endotrophin (ETP) ELISA Kit (Serum, Plasma, Cell Cultures) | SK00009-08 | 96 T |
| Human Endotrophin (ETP) ELISA Kit | SK00009-06 | 96 T |
| Mouse Endotrophin ELISA Kit (Serum, Plasma) (3 Plates) | SK00009-03 | 3 x 96 T |
| Human Endotrophin His Tag Rec. (A 1-T 91) | 00009-01-100 | 100 mg |
| Human Endotrophin His Tag (HEK293) ( Thr 1-Thr 77) | 0000-06-10 | 10 mg |
| Mouse Endotrophin His Tag Rec. (Ala 1- Val 82) | 00009-03-100 | 100 mg |
| Anti human Endotrophin IgG Biotinylated | A00009-06-50B | 50 mL |

Website: www.AvisceraBioscience.net
Email: Info@AvisceraBioscience.com

